{"product_id":"recombinant-human-cntf-proteinn-hisactive-pksh034176","title":"Recombinant Human CNTF protein(N-His)(active) - PKSH034176","description":"Recombinant Human CNTF protein(N-His)(active)\n\nSizes: 20μg, 100μg\n\nCatalogue Numbers: PKSH034176-20, PKSH034176-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: CNTF\n\nTarget Symptom: HCNTF\n\nTarget Species: Human\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: P26441\n\nAccession: P26441\n\nBackground: Ciliary neurotrophic factor(CNTF) is a member of the cytokine family. It is a polypeptide hormone that have functions in promoting neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. It's actions appear to be restricted to the nervous system. Ciliary neurotrophic factor(CNTF) has biological effects through the activation of a multi-subunit receptor complex, consisting of an extracelluar CNTF binding subunit(CNTFα ) and two transmembrane signal transduction proteins: glycoprotein gp130 and LIF receptor. CNTF is considered as a potent survival factor of neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. CNTF is also a survival factor for neurons of the peripheral sensory sympathetic, and ciliary ganglia. It has been reported that CNTF could be an agent that has therapeutic potential and possibly induces differentiation of large multipolar ganglionic phenotype in a subset of progenitors.\n\nActivity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is \u0026lt; 0.15 μg\/mL.\n\nSequence: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 7.4\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.01 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 23.76 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"20μg","offer_id":43118173487283,"sku":"PKSH034176-20","price":348.6,"currency_code":"CAD","in_stock":true},{"title":"100μg","offer_id":43118173520051,"sku":"PKSH034176-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_e74ef961-3762-4897-8f7b-cd3f94a6237f.png?v=1709637506","url":"https:\/\/afsbio.com\/products\/recombinant-human-cntf-proteinn-hisactive-pksh034176","provider":"AFSBio Inc.","version":"1.0","type":"link"}