{"product_id":"recombinant-human-fasl-proteinn-hisactive-pksh034124","title":"Recombinant Human FasL protein(N-His)(active) - PKSH034124","description":"Recombinant Human FasL protein(N-His)(active)\n\nSize: 100μg\n\nCatalogue Number: PKSH034124-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: FasL\n\nTarget Symptom: soluble Fas Ligand (sFasL); TNFSF6; CD95L; Apo I Ligand; APTL; APT1LG1; CD178\n\nTarget Species: Human\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: P48023\n\nAccession: P48023\n\nBackground: Fas Ligand, also known as FASLG and CD95L, is the ligand for FAS. It is a transmembrane protein which binds to TNFRSF6\/FAS. Interaction of FAS with fas Ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Fas Ligand may be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6\/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.\n\nActivity: Measure by its ability to induce apoptosis in Jurkat cells. The ED50 for this effect is \u0026lt; 1 ng\/mL. The specific activity of recombinant human FasL is \u0026gt; 1 x 10\u003csup\u003e6\u003c\/sup\u003eIU\/mg.\n\nSequence: MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 8.0\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 32.31 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"Default Title","offer_id":43107393044659,"sku":"PKSH034124-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_ad7af3a7-8369-4666-9b36-31275df1c077.png?v=1709383006","url":"https:\/\/afsbio.com\/products\/recombinant-human-fasl-proteinn-hisactive-pksh034124","provider":"AFSBio Inc.","version":"1.0","type":"link"}