{"product_id":"recombinant-human-fgf-18-proteinn-hisactive-pksh034159","title":"Recombinant Human FGF-18 protein(N-His)(active) - PKSH034159","description":"Recombinant Human FGF-18 protein(N-His)(active)\n\nSizes: 20μg, 100μg\n\nCatalogue Numbers: PKSH034159-20, PKSH034159-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: FGF-18\n\nTarget Symptom: FGFI; zFGF5\n\nTarget Species: Human\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: O76093\n\nAccession: O76093\n\nBackground: Fibroblast growth factor 18 (FGF18) is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that FGF18 is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Experiment datas identified FGF18 as a selective ligand for FGFR3 in limb bud mesenchymal cells, which suppressed proliferation and promoted their differentiation and production of cartilage matrix. FGF18 appears to regulate cell proliferation and differentiation positively in osteogenesis and negatively in chondrogenesis.\n\nActivity: Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 1. 3-2.0 ng\/mL. The specific activity of recombinant human FGF-18 is \u0026gt; 5 x 10\u003csup\u003e5\u003c\/sup\u003eIU\/mg.\n\nSequence: MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 8.0\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 24.82 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"20μg","offer_id":43118171488435,"sku":"PKSH034159-20","price":348.6,"currency_code":"CAD","in_stock":true},{"title":"100μg","offer_id":43118171521203,"sku":"PKSH034159-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_12226e56-63e5-4af9-8cd6-3fa739cc468c.png?v=1709637470","url":"https:\/\/afsbio.com\/products\/recombinant-human-fgf-18-proteinn-hisactive-pksh034159","provider":"AFSBio Inc.","version":"1.0","type":"link"}