{"product_id":"recombinant-human-i-tac-rhui-tac-cxcl11-pr1076","title":"Recombinant Human I-TAC (rHuI-TAC\/CXCL11) - PR1076","description":"\u003cp\u003eRecombinant Human I-TAC (rHuI-TAC\/CXCL11)\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Numbers: PR1076-5, PR1076-20\u003c\/p\u003e\n\n\u003cp\u003eSizes: 5µg, 20µg\u003c\/p\u003e\n\n\u003cp\u003eSource: Escherichia coli\u003c\/p\u003e\n\n\u003cp\u003eMolecular Weight: 8.3 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.\u003c\/p\u003e\n\n\u003cp\u003ePurity: \u0026gt;97% by SDS-PAGE and HPLC analyses.\u003c\/p\u003e\n\n\u003cp\u003eBiological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng\/ml, corresponding to a Specific Activity of ＞1 x 105 IU\/mg.\u003c\/p\u003e\n\n\u003cp\u003ePhysical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.\u003c\/p\u003e\n\n\u003cp\u003eAA Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: Less than 1EU\/mg of rHuI-TAC\/CXCL11 as determined by LAL method.\u003c\/p\u003e\n\n\u003cp\u003eReconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg\/mL. Stock solutions should be apportioned into working aliquots and stored at \u0026lt;-20°C. Further dilutions should be made in appropriate buffered solutions.\u003c\/p\u003e\n\n\u003cp\u003eStorage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze\/thaw cycles.\u003c\/p\u003e\n\n\u003cp\u003eUsage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China\u003c\/p\u003e\n\n\u003cp\u003eDescription: CXCL11 cDNA encodes a 94 amino acid (aa) residue precursor protein with a 21 aa residue putative signal sequence, which is cleaved to form the mature 73 aa residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. CXCL11 is expressed at low levels in normal tissues including thymus, spleen and pancreas. The expression of CXCL11 mRNA is radically up regulated in IFN-γ and IL-1 stimulated astrocytes. Moderate increase in expression is also observed in stimulated monocytes. CXCL11 has potent chemoattractant activity for IL-2 activated T cells and transfected cell lines expressing CXCR3, but not freshly isolated T-cells, neutrophils or monocytes.\u003c\/p\u003e","brand":"BioWorld","offers":[{"title":"5µg","offer_id":42882226258099,"sku":"PR1076-5","price":260.23,"currency_code":"CAD","in_stock":true},{"title":"20µg","offer_id":42882226290867,"sku":"PR1076-20","price":490.83,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/thumbnail_d1447bac803ec9be_11-14-09-19-51_866d0825-0b13-4a44-a257-91b237db7d89.jpg?v=1702049637","url":"https:\/\/afsbio.com\/products\/recombinant-human-i-tac-rhui-tac-cxcl11-pr1076","provider":"AFSBio Inc.","version":"1.0","type":"link"}