{"product_id":"recombinant-human-ifn-alpha-21-protein-rp01900","title":"Recombinant Human IFN-alpha 21 Protein - RP01900","description":"Recombinant Human IFN-alpha 21 Protein\n\nSizes: 10ug, 20ug, 50ug\n\nCatalogue Numbers: RP01900-10, RP01900-20, RP01900-50\n\nCitations, Manuals and MSDS Available upon request.\n\nDescription: Recombinant Human IFN-alpha 21 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Glu189) of Human IFN-alpha 21\/IFNA21 (Accession #NP_002166.2) fused with a His tag at the C-terminus.\n\nAlternate Names: IFNA21; IFN-alpha 21; IFNalpha F; IFN-alpha F; IFN-alpha-21; IFN-alphaI; interferon alpha-21; Interferon alpha-F; interferon, alpha 21; LeIF F; leukocyte interferon protein; MGC126687; MGC126689\n\nSWISS: P01568\n\nGeneID: 3452\n\nSpecies: Human\n\nPurity: ≥ 90% as determined by SDS-PAGE.\n\nStorage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.\n\nBackground: Interferons (IFN) are a family of cytokines with potent antiviral, anti-proliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors. Human IFNA2 was originally cloned in the early ‘80s and now more than a dozen closely related IFN alpha subtypes have been identified in both the human and mouse genome, each sharing about 80% amino acid (aa) sequence homology. Structurally, type I IFNs belong to the class of five helicalbundle cytokines, with the IFNA subtypes containing 2 conserved disulfide bonds. There is not a mouse homolog for IFNA21, but mature human IFNA21 is identical to chimpanzee IFNA21. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit). Individual IFNA subtypes are known to display unique efficacies to viral protection, with IFNA21 displaying intermediate activity inducing interferon stimulating genes. Further, human IFNA21 has shown weak anti-viral activity against viruses such as metapneumovirus.\n\nBio-Activity: Measured in a cell cytotoxicity assay using TF-1 cells. The ED50 for this effect is 0.50‑1.98 ng\/mL, corresponding to a specific activity of 5.05×10^5 ~2.00×10^6 units\/mg.\n\nSource: HEK293 cells\n\nTag: C-His\n\nFormulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.\n\nAntigen Sequence: CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE\n\nEndotoxin: \u0026lt; 0.01 EU\/μg of the protein by LAL method\n\nResearch Use Only","brand":"ABclonal","offers":[{"title":"10ug","offer_id":45198369030323,"sku":"RP01900-10","price":210.0,"currency_code":"CAD","in_stock":true},{"title":"20ug","offer_id":45198369063091,"sku":"RP01900-20","price":280.0,"currency_code":"CAD","in_stock":true},{"title":"50ug","offer_id":45198369095859,"sku":"RP01900-50","price":350.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/files\/download_0eab73f6-feb6-453a-a1d5-1162e3b53ad4.png?v=1766961295","url":"https:\/\/afsbio.com\/products\/recombinant-human-ifn-alpha-21-protein-rp01900","provider":"AFSBio Inc.","version":"1.0","type":"link"}