{"product_id":"recombinant-human-igg1-protein-rpt0004","title":"Recombinant Human IgG1 Protein - RPT0004","description":"\u003cp\u003eRecombinant Human IgG1 Protein\u003c\/p\u003e\n\n\u003cp\u003eSizes: 50ug, 100ug\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Number: RPT0004-50, RPT0004-100\u003c\/p\u003e\n\n\u003cp\u003eCitations, Manuals and MSDS Available upon request.\u003c\/p\u003e\n\n\u003cp\u003eDescription: Recombinant Human IgG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro100-Lys330) of human IgG1 Fc fused with a 6×His tag at the C-terminus.\u003c\/p\u003e\n\n\u003cp\u003eAlternate Names: Human IgG, IGHG1, COB1, YAP, YAP2, YAP65, YKI, YAP1, human IgG (Fc)\u003c\/p\u003e\n\n\u003cp\u003eSWISS: P01857\u003c\/p\u003e\n\n\u003cp\u003eGeneID: 3500\u003c\/p\u003e\n\n\u003cp\u003eSpecies: Human\u003c\/p\u003e\n\n\u003cp\u003ePurity: ≥ 95 % as determined by SDS-PAGE.\u003c\/p\u003e\n\n\u003cp\u003eStorage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.\u003c\/p\u003e\n\n\u003cp\u003eBackground: As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (5 kDa ) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment (\"crystallizable\" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcγR ) on phagocytic cells with high affinity. Fc fragment is demonstrated to mediate phagocytosis, trigger inflammation, and target Ig to particular tissues. Protein G or Protein A on the surface of certain Staphylococcal and Streptococcal strains specifically binds with the Fc region of IgGs, and has numerous applications in biotechnology as a reagent for affinity purification. Recombinant IgG Fc Region is suggested to represent a potential anti-inflammatory drug for treatment of human autoimmune diseases.\u003c\/p\u003e\n\n\u003cp\u003eBio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Human Fc-gamma RII-a(CD32a) at 1 μg\/mL (100 μL\/well) can bind IgG1 Fc with a linear range of 0.156-3.47 μg\/mL.\u003c\/p\u003e\n\n\u003cp\u003eSource: HEK293 cells\u003c\/p\u003e\n\n\u003cp\u003eTag: C-His\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.\u003c\/p\u003e\n\n\u003cp\u003eAntigen Sequence: PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: \u0026lt; 0.1 EU\/μg of the protein by LAL method.\u003c\/p\u003e\n\n\u003cp\u003eResearch Use Only\u003c\/p\u003e","brand":"ABclonal","offers":[{"title":"50ug","offer_id":45198362149043,"sku":"RPT0004-50","price":210.0,"currency_code":"CAD","in_stock":true},{"title":"100ug","offer_id":45198362181811,"sku":"RPT0004-100","price":224.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/files\/download_9eb0614a-1c3d-4402-9726-437a3c2dae9c.png?v=1766961195","url":"https:\/\/afsbio.com\/products\/recombinant-human-igg1-protein-rpt0004","provider":"AFSBio Inc.","version":"1.0","type":"link"}