{"product_id":"recombinant-human-migration-inhibitor-factor-rhumif-pr1092","title":"Recombinant Human Migration Inhibitor Factor (rHuMIF) - PR1092","description":"\u003cp\u003eRecombinant Human Migration Inhibitor Factor (rHuMIF)\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Numbers: PR1092-10, PR1092-50\u003c\/p\u003e\n\n\u003cp\u003eSizes: 10µg, 50µg\u003c\/p\u003e\n\n\u003cp\u003eSource: Escherichia coli\u003c\/p\u003e\n\n\u003cp\u003eMolecular Weight: Approximately 13.5 kDa, a single non-glycosylated polypeptide chain containing 123 amino acids.\u003c\/p\u003e\n\n\u003cp\u003ePurity: \u0026gt;95% by SDS-PAGE and HPLC analyses.\u003c\/p\u003e\n\n\u003cp\u003eBiological Activity: Fully biologically active measured by its ability to bind rhCD74 in a functional ELISA.\u003c\/p\u003e\n\n\u003cp\u003ePhysical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.\u003c\/p\u003e\n\n\u003cp\u003eAA Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: Less than 1EU\/mg of rHuMIF as determined by LAL method.\u003c\/p\u003e\n\n\u003cp\u003eReconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg\/mL. Stock solutions should be apportioned into working aliquots and stored at \u0026lt;-20°C. Further dilutions should be made in appropriate buffered solutions.\u003c\/p\u003e\n\n\u003cp\u003eStorage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze\/thaw cycles.\u003c\/p\u003e\n\n\u003cp\u003eUsage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China\u003c\/p\u003e\n\n\u003cp\u003eDescription: Human MIF consists of two α-helices and six β-strands, four of which form a β-sheet. The two remaining β-strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position 1. Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity. MIF has proinflammatory cytokine activity centered around aa’s 49 - 65. On fibroblasts, MIF induces, IL-1, IL-8 and MMP expression; on macrophages, MIF stimulates NO production and TNF-α release folllowing IFN-γ activation. MIF apparently acts through CD74 and CD44, likely in some form of trimeric interaction. Human MIF is active on mouse cells. Human MIF is 90%, 94%, 95%, and 90% aa identical to mouse, bovine, porcine and rat MIF, respectively.\u003c\/p\u003e","brand":"BioWorld","offers":[{"title":"10µg","offer_id":42882231140531,"sku":"PR1092-10","price":0.0,"currency_code":"CAD","in_stock":true},{"title":"50µg","offer_id":42882231173299,"sku":"PR1092-50","price":0.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/thumbnail_d1447bac803ec9be_11-14-09-19-51_7fdb0b11-0615-42f5-94ac-b4235b82a206.jpg?v=1702049732","url":"https:\/\/afsbio.com\/products\/recombinant-human-migration-inhibitor-factor-rhumif-pr1092","provider":"AFSBio Inc.","version":"1.0","type":"link"}