{"product_id":"recombinant-human-nap-2-rhunap-2-cxcl7-pr1101","title":"Recombinant Human NAP-2 (rHuNAP-2\/CXCL7) - PR1101","description":"\u003cp\u003eRecombinant Human NAP-2 (rHuNAP-2\/CXCL7)\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Numbers: PR1101-2, PR1101-10\u003c\/p\u003e\n\n\u003cp\u003eSizes: 2µg, 10µg\u003c\/p\u003e\n\n\u003cp\u003eSource: Escherichia coli\u003c\/p\u003e\n\n\u003cp\u003eMolecular Weight: 7.6 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.\u003c\/p\u003e\n\n\u003cp\u003ePurity: \u0026gt;97% by SDS-PAGE and HPLC analyses.\u003c\/p\u003e\n\n\u003cp\u003eBiological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human neutrophils using a concentration range of 1.0-10.0 ng\/ml, corresponding to a Specific Activity of ＞1 x 105 IU\/mg\u003c\/p\u003e\n\n\u003cp\u003ePhysical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.\u003c\/p\u003e\n\n\u003cp\u003eAA Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: Less than 1EU\/mg of rHuNAP-2\/CXCL7 as determined by LAL method.\u003c\/p\u003e\n\n\u003cp\u003eReconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg\/mL. Stock solutions should be apportioned into working aliquots and stored at \u0026lt;-20°C. Further dilutions should be made in appropriate buffered solutions.\u003c\/p\u003e\n\n\u003cp\u003eStorage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze\/thaw cycles.\u003c\/p\u003e\n\n\u003cp\u003eUsage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China\u003c\/p\u003e\n\n\u003cp\u003eDescription: Neutrophil Activating Peptide 2 (NAP-2) is proteolytically processed carboxyl-terminal fragments of platelet basic protein (PBP) which is found in the alpha-granules of human platelets. NAP-2 is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, NAP-2 has been shown to bind CXCR-2 and to chemoattract and activate neutrophils. Although CTAP-III, β-TG and PBP represent amino-terminal extended variants of NAP-2 and possess the same CXC chemokine domains, these proteins do not exhibit NAP-2 activity. Recently, it has been shown that the additional amino-terminal residues of CTAP-III masks the critical ELR receptor binding domain that is exposed on NAP-2 and may account for lack of NAP-2 activity.\u003c\/p\u003e","brand":"BioWorld","offers":[{"title":"2µg","offer_id":42882220032179,"sku":"PR1101-2","price":260.23,"currency_code":"CAD","in_stock":true},{"title":"10µg","offer_id":42882220064947,"sku":"PR1101-10","price":490.83,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/thumbnail_d1447bac803ec9be_11-14-09-19-51_666b5660-0188-4c22-b066-2e1a3023b07a.jpg?v=1702049498","url":"https:\/\/afsbio.com\/products\/recombinant-human-nap-2-rhunap-2-cxcl7-pr1101","provider":"AFSBio Inc.","version":"1.0","type":"link"}