{"product_id":"recombinant-human-noggin-proteinc-hisactive-pksh034199","title":"Recombinant Human Noggin protein(C-His)(active) - PKSH034199","description":"Recombinant Human Noggin protein(C-His)(active)\n\nSizes: 20μg, 100μg\n\nCatalogue Numbers: PKSH034199-20, PKSH034199-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: Noggin\n\nTarget Symptom: NOG; Noggin; SYM1; symphalangism 1 (proximal); synostoses (multiple) syndrome 1; SYNS1; SYNS1A\n\nTarget Species: Human\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: C-His\n\nUNIProt ID: Q13253\n\nAccession: Q13253\n\nBackground: Noggin is a secreted protein involved at multiple stages of vertebrate embryonic development including neural induction and is known to exert its effects by inhibiting the bone morphogenetic protein (BMP)-signaling pathway. It binds several BMPs with very high (picomolar) affinities; with a marked preference for BMP2 and BMP4 over BMP7. By binding tightly to BMPs; Noggin prevents BMPs from binding their receptors. Noggin binds the bone morphogenetic proteins (BMP) such as BMP-4 and BMP-7; and inhibits BMP signaling by blocking the molecular interfaces of the binding epitopes for both type I and type II receptors. Interaction of BMP and its antagonist Noggin governs various developmental and cellular processes; including embryonic dorsal-ventral axis; induction of neural tissue; formation of joints in the skeletal system and neurogenesis in the adult brain. Noggin plays a key role in neural induction by inhibiting BMP4; along with other TGF-β signaling inhibitors such as chordin and follistatin. Mouse knockout experiments have demonstrated that noggin also plays a crucial role in bone development; joint formation; and neural tube fusion.\n\nActivity: Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is \u0026lt; 0.05 μg\/mL in the presence of 50 ng\/mL of recombinant human BMP-4.\n\nSequence: MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from a solution containing 0.1% sarkosyl in 1X PBS, pH8.0.\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 26.60 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"20μg","offer_id":43118175584435,"sku":"PKSH034199-20","price":348.6,"currency_code":"CAD","in_stock":true},{"title":"100μg","offer_id":43118175617203,"sku":"PKSH034199-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_86925818-7f24-45d7-b757-c962dd99c4d6.png?v=1709637549","url":"https:\/\/afsbio.com\/products\/recombinant-human-noggin-proteinc-hisactive-pksh034199","provider":"AFSBio Inc.","version":"1.0","type":"link"}