{"product_id":"recombinant-human-tnfrsf12a-tweakr-cd266-protein-rp00166","title":"Recombinant Human TNFRSF12A\/TWEAKR\/CD266 Protein - RP00166","description":"\u003cp\u003eRecombinant Human TNFRSF12A\/TWEAKR\/CD266 Protein\u003c\/p\u003e\n\n\u003cp\u003eSizes: 50ug, 100ug\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Number: RP00166-50, RP00166-100\u003c\/p\u003e\n\n\u003cp\u003eCitations, Manuals and MSDS Available upon request.\u003c\/p\u003e\n\n\u003cp\u003eDescription: Recombinant Human TNFRSF12A\/TWEAKR\/CD266 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu28-Trp79) of human TNFRSF12A\/FN14\/TWEAKR (Accession #NP_057723.1) fused with an Fc, 6×His tag at the C-terminus.\u003c\/p\u003e\n\n\u003cp\u003eAlternate Names: CD266, FN14, TWEAKR, TNFRSF12A, FN14, TWEAKR\u003c\/p\u003e\n\n\u003cp\u003eSWISS: Q9NP84\u003c\/p\u003e\n\n\u003cp\u003eGeneID: 51330\u003c\/p\u003e\n\n\u003cp\u003eSpecies: Human\u003c\/p\u003e\n\n\u003cp\u003ePurity: ≥ 90 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.\u003c\/p\u003e\n\n\u003cp\u003eStorage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.\u003c\/p\u003e\n\n\u003cp\u003eBackground: Fn14 (tumor necrosis factor receptor superfamily, member 12A), also known as TNFRSF12A, is the receptor for TNFSF12\/TWEAK. Human and mouse TNFRSF12A share 82% aa sequence identity. TNFRSF12A transcript was expressed at high levels in heart, placenta, and kidney, at intermediate levels in lung, skeletal muscle, and pancreas, and at low levels in brain and liver. In addition, elevated TNFRSF12A expression was found in human liver cancer cell lines and hepatocellular carcinoma specimens. TNFRSF12A is the weak inducer of apoptosis in some cell types. It promotes angiogenesis and the proliferation of endothelial cells. TNFRSF12A may modulate cellular adhesion to matrix proteins.\u003c\/p\u003e\n\n\u003cp\u003eBio-Activity: 1.Measured by its ability to inhibit TWEAK-induced apoptosis in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 2-12 μg\/mL in the presence of 1 μg\/mL recombinant human TWEAK.|2.Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF12 at 2 μg\/mL (100 μL\/well) can bind Human TNFRSF12A with a linear range of 0.1-2.3 ng\/mL.|3.Measured by its ability to inhibit the TWEAK-dependent proliferation of HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 20-80 ng\/mL in the presence of 15 ng\/mL recombinant human TWEAK.\u003c\/p\u003e\n\n\u003cp\u003eSource: HEK293 cells\u003c\/p\u003e\n\n\u003cp\u003eTag: C-hFc\u0026amp;His\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.\u003c\/p\u003e\n\n\u003cp\u003eAntigen Sequence: EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: \u0026lt; 0.1 EU\/μg of the protein by LAL method.\u003c\/p\u003e\n\n\u003cp\u003eResearch Use Only\u003c\/p\u003e","brand":"ABclonal","offers":[{"title":"50ug","offer_id":45198361624755,"sku":"RP00166-50","price":280.0,"currency_code":"CAD","in_stock":true},{"title":"100ug","offer_id":45198361657523,"sku":"RP00166-100","price":448.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/files\/download_b0f1d22d-9b17-450a-817e-5e3a66de4188.png?v=1766961184","url":"https:\/\/afsbio.com\/products\/recombinant-human-tnfrsf12a-tweakr-cd266-protein-rp00166","provider":"AFSBio Inc.","version":"1.0","type":"link"}