{"product_id":"recombinant-human-vegf165-proteinn-hisactive-pksh034126","title":"Recombinant Human VEGF165 protein(N-His)(active) - PKSH034126","description":"Recombinant Human VEGF165 protein(N-His)(active)\n\nSize: 100μg\n\nCatalogue Number: PKSH034126-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: VEGF165\n\nTarget Symptom: VPF; Folliculostellate cell-derived growth factor; Glioma-derived endothelial cell mitogen\n\nTarget Species: Human\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: P15692\n\nAccession: P15692-4\n\nBackground: Vascular endothelial growth factor (VEGF); also known as vascular permeability factor (VPF) and VEGF-A; is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the platelet-derived growth factor (PDGF)\/vascular endothelial growth factor (VEGF) family and often exists as a disulfide-linked homodimer. VEGF-A protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects; including mediating increased vascular permeability; inducing angiogenesis; vasculogenesis and endothelial cell growth; promoting cell migration; inhibiting apoptosis and tumor growth. VEGF-A protein is also a vasodilator that increases microvascular permeability; thus it was originally referred to as vascular permeability factor.\n\nActivity: Measure by its ability to induce HUVEC cells proliferation. The ED50 for this effect is \u0026lt; 5 ng\/mL. The specific activity of recombinant human VEGF165 is approximately \u0026gt; 1. 4 x 10\u003csup\u003e6\u003c\/sup\u003eIU\/mg.\n\nSequence: MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 8.0\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 27.87 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"Default Title","offer_id":43107393142963,"sku":"PKSH034126-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_3d968182-d0f3-4ba4-83f2-03d307f37491.png?v=1709383011","url":"https:\/\/afsbio.com\/products\/recombinant-human-vegf165-proteinn-hisactive-pksh034126","provider":"AFSBio Inc.","version":"1.0","type":"link"}