{"product_id":"recombinant-il-2rα-his-human-bk0314","title":"Recombinant IL-2Rα, His, Human - BK0314","description":"\u003cp\u003eRecombinant IL-2Rα, His, Human\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Numbers: BK0314-10, BK0314-50\u003c\/p\u003e\n\n\u003cp\u003eSizes: 10μg, 50μg\u003c\/p\u003e\n\n\u003cp\u003eSource: HEK 293\u003c\/p\u003e\n\n\u003cp\u003eMolecular Weight: 42 kDa, observed by reducing SDS-PAGE.\u003c\/p\u003e\n\n\u003cp\u003ePurity: \u0026gt; 95% as analyzed by SDS-PAGE and HPLC.\u003c\/p\u003e\n\n\u003cp\u003eBiological Activity: Determined by its ability to increase the proliferation effect of IL-2 in murine CTLL-2 cells. In the presence of 1 ng\/ml of recombinant IL-2, ED50 for this effect is \u0026lt; 1.5 µg\/ml.\u003c\/p\u003e\n\n\u003cp\u003ePhysical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized after extensive dialysis against PBS.\u003c\/p\u003e\n\n\u003cp\u003eAA Sequence: HHHHHHHHELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQ\u003cbr\u003e\n KERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQ\u003cbr\u003e\n LICTGEMETSQFPGEEKPQASPEGRPESETSC\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: \u0026lt; 0.2 EU\/μg, determined by LAL method.\u003c\/p\u003e\n\n\u003cp\u003eReconstitution: Reconstituted in ddH2O or PBS at 100 μg\/ml.\u003c\/p\u003e\n\n\u003cp\u003eStorage: Lyophilized recombinant Human Interleukin-2 Receptor α remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-2 Receptor α should be stable up to 1 week at 4°C or up to 3 months at -20°C.\u003c\/p\u003e\n\n\u003cp\u003eUsage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.\u003c\/p\u003e\n\n\u003cp\u003eDescription: Interleukin-2 receptor (IL-2R) is a heterotrimeric protein expressed on the surface of certain immune cells, such as lymphocytes, that binds and responds to the cytokine IL-2. The IL-2R is made up of 3 subunits - alpha (α), beta (β) and gamma (γ). The α and β chains are involved in binding IL-2, while signal transduction following cytokine interaction is carried out by the γ-chain, along with the β subunit. The β and γ chains of the IL-2R are members of the type I cytokine receptor family. IL-2R has a high binding affinity to IL-2 and is expressed by antigen-activated T lymphocytes (T cells). IL-2 Rα is also known as CD25, p55, and Tac (activated T cell) antigen.Recombinant Human Interleukin-2 Receptor α (IL-2 R α), His produced in HEK 293 cells is a polypeptide chain containing 205 amino acids. A fully biologically active molecule, rhIL-2 R α has a molecular mass of 42 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.\u003c\/p\u003e","brand":"BioWorld","offers":[{"title":"10μg","offer_id":42882262532275,"sku":"BK0314-10","price":217.41,"currency_code":"CAD","in_stock":true},{"title":"50μg","offer_id":42882262565043,"sku":"BK0314-50","price":691.77,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/thumbnail_d1447bac803ec9be_11-14-09-19-51_bceef16c-607b-4f03-8045-885e4ec6b4f1.jpg?v=1702050291","url":"https:\/\/afsbio.com\/products\/recombinant-il-2r%ce%b1-his-human-bk0314","provider":"AFSBio Inc.","version":"1.0","type":"link"}