{"product_id":"recombinant-mouse-bmp-4-proteinn-hisactive-pksm041491","title":"Recombinant Mouse BMP-4 protein(N-His)(active) - PKSM041491","description":"Recombinant Mouse BMP-4 protein(N-His)(active)\n\nSizes: 20μg, 100μg\n\nCatalogue Numbers: PKSM041491-20, PKSM041491-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: BMP-4\n\nTarget Symptom: interleukin 1 family; member 9; IL-1F9; IL-1ε (epsilon) and IL-1H1\n\nTarget Species: Mouse\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: P21275\n\nAccession: P21275\n\nBackground: Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including neurogenesis, vascular development, angiogenesis and osteogenesis. Acts in concert with PTHLH\/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. Once all three components are bound together in a complex at the cell surface, BMPR2 phosphorylates and activates BMPR1A. In turn, BMPR1A propagates signal by phosphorylating SMAD1\/5\/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical BMP pathways such as ERK\/MAP kinase, PI3K\/Akt or SRC cascades. For example, induces SRC phosphorylation which, in turn, activates VEGFR2, leading to an angiogenic response.\n\nActivity: Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is \u0026lt; 10 ng\/mL. The specific activity of recombinant mouse BMP-4 is \u0026gt; 1 x 10\u003csup\u003e5\u003c\/sup\u003eIU\/mg.\n\nSequence: MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRSFHHEEHLENIPGTSESSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPAEMVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHTLTRRRAKRSPKHHPQRSRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from a solution containing 20 mM sodium carbonate, pH 4.5.\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 47.33 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"20μg","offer_id":43118182334643,"sku":"PKSM041491-20","price":348.6,"currency_code":"CAD","in_stock":true},{"title":"100μg","offer_id":43118182367411,"sku":"PKSM041491-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_d0c463ec-84a2-40bb-829b-8f61f084f89d.png?v=1709637665","url":"https:\/\/afsbio.com\/products\/recombinant-mouse-bmp-4-proteinn-hisactive-pksm041491","provider":"AFSBio Inc.","version":"1.0","type":"link"}