{"product_id":"recombinant-mouse-g-csf-proteinn-his-pksm041499","title":"Recombinant Mouse G-CSF protein(N-His) - PKSM041499","description":"Recombinant Mouse G-CSF protein(N-His)\n\nSizes: 20μg, 100μg\n\nCatalogue Numbers: PKSM041499-20, PKSM041499-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: G-CSF\n\nTarget Symptom: soluble Receptor Activator of NF-kB Ligand; TNFSF11; TRANCE (TNF-Related Activation-induced Cytokine); \nOPGL; ODF (Osteoclast Differentiation Factor); CD254; sRNAK Ligand\n\nTarget Species: Mouse\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: P09920\n\nAccession: P09920\n\nBackground: Granulocyte colony-stimulating factor (G-CSF) is a growth factor and an essential cytokine which belongs to the IL-6 superfamily. Granulocyte\/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. G-CSF binding to its receptor G-CSF-R which belongs to the cytokine receptor type I family depends on the interaction of alpha-helical motifs of the former and two fibronectin type III as well as an immunoglobulin-like domain of the latter. G-CSF is a cytokine that have been demonstrated to improve cardiac function and perfusion in myocardial infarction. And it was initially evaluated as a stem cell mobilizer and erythropoietin as a cytoprotective agent.\n\nActivity: Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is \u0026lt; 50 pg\/mL. The specific activity of recombinant mouse G-CSF is \u0026gt; 2 x 10\u003csup\u003e7\u003c\/sup\u003eIU\/mg.\n\nSequence: MAQLSAQRRMKLMALQLLLWQSALWSGREAVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 7.4\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 23.25 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"20μg","offer_id":43118183284915,"sku":"PKSM041499-20","price":348.6,"currency_code":"CAD","in_stock":true},{"title":"100μg","offer_id":43118183317683,"sku":"PKSM041499-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_8da41588-803d-44a8-b56f-ca59f373d31a.png?v=1709637690","url":"https:\/\/afsbio.com\/products\/recombinant-mouse-g-csf-proteinn-his-pksm041499","provider":"AFSBio Inc.","version":"1.0","type":"link"}