{"product_id":"recombinant-mouse-il-15-proteinn-hisactive-pksm041466","title":"Recombinant Mouse IL-15 protein(N-His)(active) - PKSM041466","description":"Recombinant Mouse IL-15 protein(N-His)(active)\n\nSizes: 20μg, 100μg\n\nCatalogue Numbers: PKSM041466-20, PKSM041466-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: IL-15\n\nTarget Symptom: IL-15; Interleukin 15; IL15\n\nTarget Species: Mouse\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: P48346\n\nAccession: P48346\n\nBackground: Human Interleukin 15 (IL-15) is a cytokine that regulates T cell and natural killer cell activation and proliferation. IL-15 binds to the alpha subunit of the IL15 receptor (IL-15RA) with high affinity. IL-15 also binds to the beta and gamma chains of the IL-2 receptor, but not the alpha subunit of the IL2 receptor. IL-15 is structurally and functionally related to IL-2. Both cytokines share some subunits of receptors, allowing them to compete for and negatively regulate each other' s activity. The number of CD8+ memory T cells is controlled by a balance between IL-15 and IL-2. Despite their many overlapping functional properties, IL-2 and IL-15 are, in fact, quite distinct players in the immune system. IL-15 is constitutively expressed by a wide variety of cell types and tissues, including monocytes, macrophages and DCs. Mature Human IL-15 shares 70% amino acid sequence identity with Mouse and Rat IL-15.\n\nActivity: Measure by its ability to induce CTLL-2 cells proliferation. The ED50 for this effect is \u0026lt; 10 ng\/mL. The specific activity of recombinant mouse IL-15 is approximately \u0026gt; 1x 10\u003csup\u003e5\u003c\/sup\u003eIU\/mg.\n\nSequence: MKILKPYMRNTSISCYLCFLLNSHFLTEAGIHVFILGCVSVGLPKTEANWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 7.4\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 19.42 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"20μg","offer_id":43118177616051,"sku":"PKSM041466-20","price":348.6,"currency_code":"CAD","in_stock":true},{"title":"100μg","offer_id":43118177648819,"sku":"PKSM041466-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_ebbb0768-4219-4c0e-878b-0476db8e28ba.png?v=1709637573","url":"https:\/\/afsbio.com\/products\/recombinant-mouse-il-15-proteinn-hisactive-pksm041466","provider":"AFSBio Inc.","version":"1.0","type":"link"}