{"product_id":"recombinant-mouse-il-18-protein-rp02521","title":"Recombinant Mouse IL-18 Protein - RP02521","description":"Recombinant Mouse IL-18 Protein\n\nSizes: 10ug, 20ug, 50ug\n\nCatalogue Numbers: RP02521-10, RP02521-20, RP02521-50\n\nCitations, Manuals and MSDS Available upon request.\n\nDescription: Recombinant Mouse IL-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence of Mouse IL-18 fused with His tag at the C-terminus\n\nAlternate Names: Ig, Il-, Igif, Il-18, IL18\n\nSWISS: P70380\n\nGeneID: 16173\n\nSpecies: Mouse\n\nPurity: ≥ 95 % as determined by SDS-PAGE.\n\nStorage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.\n\nBackground: Interleukin-18 (L-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the interleukin-18 receptor, and together with IL-12 it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-γ (IFN-γ) or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.\n\nBio-Activity: Measured by its ability to induce IFN-gamma secretion by KG1 human acute myelogenous leukemia cells in the presence of TNF-alpha(Catalog: RP00001). The ED50 for this effect is 42.93-171.72 ng\/mL, corresponding to a specific activity of 0.58×10^4 ~2.3×10^5 units\/mg.\n\nSource: HEK293 cells\n\nTag: C-His\n\nFormulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.\n\nAntigen Sequence: NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS\n\nEndotoxin: \u0026lt; 0.1 EU\/μg of the protein by LAL method.\n\nResearch Use Only","brand":"ABclonal","offers":[{"title":"10ug","offer_id":45198370406579,"sku":"RP02521-10","price":210.0,"currency_code":"CAD","in_stock":true},{"title":"20ug","offer_id":45198370439347,"sku":"RP02521-20","price":280.0,"currency_code":"CAD","in_stock":true},{"title":"50ug","offer_id":45198370472115,"sku":"RP02521-50","price":350.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/files\/download_5ec11efc-9a7b-4fd4-a04d-ab092613ed82.png?v=1766961319","url":"https:\/\/afsbio.com\/products\/recombinant-mouse-il-18-protein-rp02521","provider":"AFSBio Inc.","version":"1.0","type":"link"}