{"product_id":"recombinant-mouse-il-19-protein-rp01890","title":"Recombinant Mouse IL-19 Protein - RP01890","description":"\u003cp\u003eRecombinant Mouse IL-19 Protein\u003c\/p\u003e\n\n\u003cp\u003eSizes: 10ug, 20g, 50ug, 100ug\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Numbers: RP01890-10, RP01890-20, RP01890-50, RP01890-100\u003c\/p\u003e\n\n\u003cp\u003eCitations, Manuals and MSDS Available upon request.\u003c\/p\u003e\n\n\u003cp\u003eDescription: Recombinant Mouse IL-19 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Ala176) of Mouse IL-19 (Accession #NP_001009940.1) fused with a His tag at the C-terminus.\u003c\/p\u003e\n\n\u003cp\u003eAlternate Names: IL-10C; IL19; IL-19; interleukin 19; MDA1; melanoma differentiation associated protein-like protein; NG.1Melanoma differentiation-associated protein-like protein; ZMDA1interleukin-19\u003c\/p\u003e\n\n\u003cp\u003eSWISS: Q8CJ70\u003c\/p\u003e\n\n\u003cp\u003eGeneID: 329244\u003c\/p\u003e\n\n\u003cp\u003eSpecies: Mouse\u003c\/p\u003e\n\n\u003cp\u003ePurity: ≥ 95 % as determined by SDS-PAGE.\u003c\/p\u003e\n\n\u003cp\u003eStorage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.\u003c\/p\u003e\n\n\u003cp\u003eBackground: Interleukin 19 (IL-19) is a member of the IL-10 family of cytokines. The IL-10 family is a class II alpha -helical collection of cytokines that contains two groups, a viral homolog and a cellular homolog group. Within the cellular homolog group, there are two additional groupings, one which uses IL-10 R2 as a signal transducing receptor (IL-10, IL-22 and IL-26), and one which uses IL-20 R2 as a signal transducing receptor (IL-19, IL-20 and IL-24). Mouse IL-19 is synthesized as a 176 amino acid (aa) precursor that contains a 24 aa signal sequence and a 152 aa mature region. Based on human studies, it is expected to be secreted as a glycosylated monomer, 35 - 45 kDa in size. IL-19 is unusual in that it contains seven amphipathic helices. Mature mouse IL-19 shares 69% aa sequence identity with the mature human IL-19, and 85% and 68% aa identity to unpublished Genbank sequences for rat and canine IL-19, respectively. Although mouse IL-19 is active on human cells, human IL-19 is not active on mouse cells. IL-19 expression is limited to activated keratinocytes and monocytes, with a possible contribution from B cells. IL-19 binds a receptor complex consisting of the IL-20 receptor alpha (also known as IL-20 R1) and the IL-20 receptor beta (IL-20 R2). This receptor complex is also shared by IL-20 and IL-24. Notably, IL-19 is reported to actually bind to IL-20 R2, which is generally considered to be only the signal transducing receptor subunit. Functionally, it has been reported that IL-19 both will and will not induce IL-6 and TNF production by monocytes. It does, however, seem to drive T-helper cell differentiation towards a Th2 response, inducing both IL-10 and production of itself.\u003c\/p\u003e\n\n\u003cp\u003eSource: HEK293 cells\u003c\/p\u003e\n\n\u003cp\u003eTag: C-His\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.\u003c\/p\u003e\n\n\u003cp\u003eAntigen Sequence: LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: \u0026lt; 0.1 EU\/μg of the protein by LAL method.\u003c\/p\u003e\n\n\u003cp\u003eResearch Use Only\u003c\/p\u003e","brand":"ABclonal","offers":[{"title":"10ug","offer_id":45198254670003,"sku":"RP01890-10","price":210.0,"currency_code":"CAD","in_stock":true},{"title":"20ug","offer_id":45198254702771,"sku":"RP01890-20","price":280.0,"currency_code":"CAD","in_stock":true},{"title":"50ug","offer_id":45198254735539,"sku":"RP01890-50","price":350.0,"currency_code":"CAD","in_stock":true},{"title":"100ug","offer_id":45198254768307,"sku":"RP01890-100","price":560.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/files\/download_09d160d2-1d8d-4e57-abbf-85765e6502ca.png?v=1766959780","url":"https:\/\/afsbio.com\/products\/recombinant-mouse-il-19-protein-rp01890","provider":"AFSBio Inc.","version":"1.0","type":"link"}