{"product_id":"recombinant-mouse-il-20-protein-rp01951","title":"Recombinant Mouse IL-20 Protein - RP01951","description":"\u003cp\u003eRecombinant Mouse IL-20 Protein\u003c\/p\u003e\n\n\u003cp\u003eSizes: 10ug, 20g, 50ug, 100ug\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Numbers: RP01951-10, RP01951-20, RP01951-50, RP01951-100\u003c\/p\u003e\n\n\u003cp\u003eCitations, Manuals and MSDS Available upon request.\u003c\/p\u003e\n\n\u003cp\u003eDescription: Recombinant Mouse IL-20 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Leu176)of Mouse IL-20 (Accession #Q9JKV9) fused with a His tag at the N-terminus.\u003c\/p\u003e\n\n\u003cp\u003eAlternate Names: Il20, Zcyto10, Interleukin-20, IL-20, Cytokine Zcyto10\u003c\/p\u003e\n\n\u003cp\u003eSWISS: Q9JKV9\u003c\/p\u003e\n\n\u003cp\u003eGeneID: 58181\u003c\/p\u003e\n\n\u003cp\u003eSpecies: Mouse\u003c\/p\u003e\n\n\u003cp\u003ePurity: ≥ 95 % as determined by SDS-PAGE.\u003c\/p\u003e\n\n\u003cp\u003eStorage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.\u003c\/p\u003e\n\n\u003cp\u003eBackground: Mouse Interleukin 20 (IL-20) was identified by searching sequence databases for translated sequences with a signal sequence and amphipathic helices found in helical cytokines. Based on the human molecule, mouse IL-20 was discovered in a skin library. Mouse IL-20 is synthesized as a 176 amino acid (aa) precursor that contains a 24 aa signal sequence and a 152 aa mature segment. There are no N-linked glycosylation sites and it is doubtful that the native molecule is glycosylated. Although IL-20 is a distant member of the IL-10 family, it functions as a monomer. IL-20 shares less than 40% aa sequence identity with other IL-10 family members. Mouse and human IL-20 are 77% aa identical in the mature segment. IL-20 production has been found in skin and trachea. In particular, activated keratinocytes and, possibly, monocytes are reported to express IL-20. There are two heterodimeric receptor complexes for IL-20. The first complex is composed of IL-20 R alpha and IL‑20 R beta. The second complex is composed of IL-22 R and IL‑20 R beta. Whereas the IL-22 R\/IL-20 R beta complex is shared with IL-24\/mda-7, the IL‑20 R alpha \/IL‑20 R beta complex is shared with both IL-19 and IL-24. Little is known about the function of IL-20. It is reported to induce the proliferation of multipotential hematopoietic progenitor cells, direct the differentiation and expansion of keratinocytes, and promote the release of proinflammatory mediators in keratinocytes and other IL-20 receptor expressing cells.\u003c\/p\u003e\n\n\u003cp\u003eSource: HEK293 cells\u003c\/p\u003e\n\n\u003cp\u003eTag: N-His\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized from a 0.22 μm filtered solution of 20mM PB,500mM NaCl, pH 8.0.\u003c\/p\u003e\n\n\u003cp\u003eAntigen Sequence: LKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: \u0026lt; 0.01 EU\/μg of the protein by LAL method\u003c\/p\u003e\n\n\u003cp\u003eResearch Use Only\u003c\/p\u003e","brand":"ABclonal","offers":[{"title":"10ug","offer_id":45198244905139,"sku":"RP01951-10","price":210.0,"currency_code":"CAD","in_stock":true},{"title":"20ug","offer_id":45198244937907,"sku":"RP01951-20","price":280.0,"currency_code":"CAD","in_stock":true},{"title":"50ug","offer_id":45198244970675,"sku":"RP01951-50","price":350.0,"currency_code":"CAD","in_stock":true},{"title":"100ug","offer_id":45198245003443,"sku":"RP01951-100","price":560.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/files\/download_fb957979-4274-4f4a-9eae-f68fad4ac0c0.png?v=1766959664","url":"https:\/\/afsbio.com\/products\/recombinant-mouse-il-20-protein-rp01951","provider":"AFSBio Inc.","version":"1.0","type":"link"}