{"product_id":"recombinant-mouse-il-20-proteinn-hisactive-pksm041468","title":"Recombinant Mouse IL-20 protein(N-His)(active) - PKSM041468","description":"\u003cp\u003eRecombinant Mouse IL-20 protein(N-His)(active)\u003c\/p\u003e\n\n\u003cp\u003eSizes: 20μg, 100μg\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Numbers: PKSM041468-20, PKSM041468-100\u003c\/p\u003e\n\n\u003cp\u003eCitations, Manuals and MSDS Available upon request.\u003c\/p\u003e\n\n\u003cp\u003eAbbreviation: IL-20\u003c\/p\u003e\n\n\u003cp\u003eTarget Symptom: Interleukin-20; IL-20; Cytokine Zcyto10; IL20; ZCYTO10\u003c\/p\u003e\n\n\u003cp\u003eTarget Species: Mouse\u003c\/p\u003e\n\n\u003cp\u003eExpression Host: E.coli\u003c\/p\u003e\n\n\u003cp\u003eApplication: Cell culture\u003c\/p\u003e\n\n\u003cp\u003eFusion Tag: N-His\u003c\/p\u003e\n\n\u003cp\u003eUNIProt ID: Q9JKV9\u003c\/p\u003e\n\n\u003cp\u003eAccession: Q9JKV9\u003c\/p\u003e\n\n\u003cp\u003eBackground: Interleukin-20 (IL-20) is a member of the IL-10 family of regulatory cytokines that includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. IL-20 exhibits approximately 28% amino acid identity with IL-10 and 76% amino acid identity with mouse IL-20. There are two heterodimeric receptor complexes for IL-20. The first is composed of IL-20 Rα and IL-20 Rβ. The second is composed of IL-22 R and IL-20 Rβ. Whereas the IL-22 R\/IL-20 Rβ complex is shared with IL-24, the IL-20 Rα\/IL-20 Rβ complex is shared with both IL-19 and IL-24. IL-20 has been shown to initiate transduction cascades involving STAT3 and stimulates the induction of pro-inflammatory genes including TNF-α and MCP-1. Initial functional studies using transgenic mice suggest that IL-20 has the ability to regulate skin development. The over-expression of both human and mouse forms of IL-20 results in keratinocyte hyper-proliferation, abnormal epidermal differentiation, and neonatal lethality. In humans, IL-20 and its receptors are up-regulated in psoriatic skin, and polymorphisms in the IL-20 gene have been associated with plaque-type psoriasis. IL-20 may also have a role in hematopoiesis. It enhances the proliferation of multi-potential progenitors in vitro and increases their numbers and cell cycling status in IL-20 transgenic mice. IL-20 is also shown to suppress COX-2 and PGE2 and acts as an inhibitor of angiogenesis in model systems.\u003c\/p\u003e\n\n\u003cp\u003eActivity: Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is \u0026lt; 2 ng\/mL.\u003c\/p\u003e\n\n\u003cp\u003eSequence: MKGFGLAFGLFSAVGFLLWTPLTGLKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML\u003c\/p\u003e\n\n\u003cp\u003ePurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized from sterile PBS, pH 7.4\u003cbr\u003e\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\u003cbr\u003e\nPlease refer to the specific buffer information in the printed manual.\u003c\/p\u003e\n\n\u003cp\u003eReconstitution: Please refer to the printed manual for detailed information.\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\u003c\/p\u003e\n\n\u003cp\u003eCalculated MW: 20.92 kDa\u003c\/p\u003e\n\n\u003cp\u003eStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\u003c\/p\u003e\n\n\u003cp\u003eShipping: This product is provided as lyophilized powder which is shipped with ice packs.\u003c\/p\u003e\n\n\u003cp\u003eResearch Use Only\u003c\/p\u003e","brand":"Elabscience","offers":[{"title":"20μg","offer_id":43118178009267,"sku":"PKSM041468-20","price":348.6,"currency_code":"CAD","in_stock":true},{"title":"100μg","offer_id":43118178042035,"sku":"PKSM041468-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_37662ddd-6b34-4e77-8565-2a7b19db6503.png?v=1709637583","url":"https:\/\/afsbio.com\/products\/recombinant-mouse-il-20-proteinn-hisactive-pksm041468","provider":"AFSBio Inc.","version":"1.0","type":"link"}