{"product_id":"recombinant-mouse-il-36ra-proteinn-hisactive-pksm041482","title":"Recombinant Mouse IL-36RA protein(N-His)(active) - PKSM041482","description":"Recombinant Mouse IL-36RA protein(N-His)(active)\n\nSizes: 20μg, 100μg\n\nCatalogue Numbers: PKSM041482-20, PKSM041482-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: IL-36RA\n\nTarget Symptom: Interleukin-27 subunit alpha; IL-27-A; Interleukin-27 subunit beta; IL-27B; Epstein-Barr virus-induced gene 3 protein; EBV-induced gene 3 protein; EBI3; p28; Interleukin-30; IL-30\n\nTarget Species: Mouse\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: Q9QYY1\n\nAccession: Q9QYY1\n\nBackground: Human Interleukin-36 Receptor Antagonist (IL-36RN) is a secreted protein which belongs to the Interleukin 1 cytokine family (IL-1 family). IL-36RN is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RN is also detected in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. IL-36RN is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to Interleukin 1 family member 9 (IL1F9). Dysregulated expression of novel agonistic and antagonistic IL-1 family member ligands can promote cutaneous inflammation, revealing potential novel targets for the treatment of inflammatory skin disorders. Human and mouse IL-36RN share 90% sequence identity.\n\nActivity: Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED50 for this effect is \u0026lt; 2 ng\/mL.\n\nSequence: MMVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 7.4\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 17.96 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"20μg","offer_id":43118180565171,"sku":"PKSM041482-20","price":348.6,"currency_code":"CAD","in_stock":true},{"title":"100μg","offer_id":43118180597939,"sku":"PKSM041482-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_4a6bb785-78cf-4a87-886e-f6b1848dbdfb.png?v=1709637634","url":"https:\/\/afsbio.com\/products\/recombinant-mouse-il-36ra-proteinn-hisactive-pksm041482","provider":"AFSBio Inc.","version":"1.0","type":"link"}