{"product_id":"recombinant-mouse-il-7-proteinn-hisactive-pksm041462","title":"Recombinant Mouse IL-7 protein(N-His)(active) - PKSM041462","description":"Recombinant Mouse IL-7 protein(N-His)(active)\n\nSizes: 20μg, 100μg\n\nCatalogue Numbers: PKSM041462-20, PKSM041462-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: IL-7\n\nTarget Symptom: Interleukin-7; IL-7; IL7\n\nTarget Species: Mouse\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: P10168\n\nAccession: P10168\n\nBackground: Mouse interleukin-7(IL-7) is the member of hemopoietin family which is important to the differentiation, proliferation, and survival of lymphocyte. Mouse IL-7 shares approximately 88% aa sequence identity with rat IL-7 and 58-60% with human, equine, bovine, ovine, porcine, feline and canine IL-7. It is widely expressed in primary and secondary lymphoid tissues cell and stromal epithelial cells of the thymus, bone marrow, and intestines. IL-7 activation of IL-7 R alpha is critical for both T cell and B cell lineage development. It is important for proliferation during certain stages of B-cell maturation. IL-7 contributes to the maintenance of all naive and memory T cells, mainly by promoting expression of the anti-apoptotic protein Bcl-2. It is required for optimal T cell-dendritic cell interaction.\n\nActivity: Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is \u0026lt; 0.2 ng\/mL. The specific activity of recombinant mouse IL-7 is \u0026gt; 5 x 10\u003csup\u003e6\u003c\/sup\u003eIU\/mg.\n\nSequence: MFHVSFRYIFGIPPLILVLLPVTSSECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 7.4\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 18.55 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"20μg","offer_id":43118176403635,"sku":"PKSM041462-20","price":348.6,"currency_code":"CAD","in_stock":true},{"title":"100μg","offer_id":43118176436403,"sku":"PKSM041462-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_153fda49-37d4-4c91-8c4b-18eb1252c6c5.png?v=1709637560","url":"https:\/\/afsbio.com\/products\/recombinant-mouse-il-7-proteinn-hisactive-pksm041462","provider":"AFSBio Inc.","version":"1.0","type":"link"}