{"product_id":"recombinant-mouse-il-9-proteinn-hisactive-pksm041475","title":"Recombinant Mouse IL-9 protein(N-His)(active) - PKSM041475","description":"Recombinant Mouse IL-9 protein(N-His)(active)\n\nSizes: 20μg, 100μg\n\nCatalogue Numbers: PKSM041475-20, PKSM041475-100\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: IL-9\n\nTarget Symptom: Interleukin-12 subunit beta; IL-12 subunit p40; IL-12B; Cytotoxic Lymphocyte Maturation Factor 40 kDa subunit (CLMF p40); NK cell Stimulating Factor Chain 2\n\nTarget Species: Mouse\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: P15247\n\nAccession: P15247\n\nBackground: Interleukin-9 (IL-9) is a secreted protein that belongs to the IL-7\/IL-9 family.Mature mouse IL-9 shares 57% and 74% amino acid sequence identity with human and rat IL-9, respectively. IL-9 supports IL-2 independent and IL-4 independent growth of helper T-cells. IL-9 stimulates cell proliferation and prevents apoptosis. It functions through the IL-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 has been identified as a candidate gene for asthma. IL-9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.\n\nActivity: Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is \u0026lt; 0.2 ng\/mL. The specific activity of recombinant mouse IL-9 is \u0026gt; 5 x 10\u003csup\u003e6\u003c\/sup\u003eIU\/mg.\n\nSequence: MLVTYILASVLLFSSVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 7.4\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: \u0026lt; 0.1 EU per μg of the protein as determined by the LAL method.\n\nCalculated MW: 16.90 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"20μg","offer_id":43118179582131,"sku":"PKSM041475-20","price":348.6,"currency_code":"CAD","in_stock":true},{"title":"100μg","offer_id":43118179614899,"sku":"PKSM041475-100","price":1034.6,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_9070bd2e-2250-4fd4-9baf-d4a75505a304.png?v=1709637609","url":"https:\/\/afsbio.com\/products\/recombinant-mouse-il-9-proteinn-hisactive-pksm041475","provider":"AFSBio Inc.","version":"1.0","type":"link"}