{"product_id":"recombinant-rat-il-3-protein-rp01789","title":"Recombinant Rat IL-3 Protein - RP01789","description":"Recombinant Rat IL-3 Protein\n\nSizes: 10ug, 20g, 50ug, 100ug\n\nCatalogue Numbers: RP01789-10, RP01789-20, RP01789-50, RP01789-100\n\nCitations, Manuals and MSDS Available upon request.\n\nDescription: Recombinant Rat IL-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile27-Cys169) of rat IL-3 (Accession #NP_113701.1) fused with a 6×His tag at the C-terminus.\n\nAlternate Names: IL-3; IL3\n\nSWISS: P97688\n\nGeneID: 24495\n\nSpecies: Rat\n\nPurity: ≥ 95 % as determined by SDS-PAGE.\n\nStorage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.\n\nBackground: IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3\/IL-3 also belongs to the group of interleukins. Interleukins are produced by a wide variety of body cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4+ T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3\/IL-3 is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation, and apoptosis. IL3\/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.\n\nBio-Activity: Measured in a cell proliferation assay using NFS60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 2.6‑10.6 ng\/mL,corresponding to a specific activity of 9.4×10^4 ~3.85×10^5 units\/mg.\n\nSource: HEK293 cells\n\nTag: C-His\n\nFormulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.\n\nAntigen Sequence: ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC\n\nEndotoxin: \u0026lt; 0.1 EU\/μg of the protein by LAL method.\n\nResearch Use Only","brand":"ABclonal","offers":[{"title":"10ug","offer_id":45198337933491,"sku":"RP01789-10","price":210.0,"currency_code":"CAD","in_stock":true},{"title":"20ug","offer_id":45198337966259,"sku":"RP01789-20","price":280.0,"currency_code":"CAD","in_stock":true},{"title":"50ug","offer_id":45198337999027,"sku":"RP01789-50","price":350.0,"currency_code":"CAD","in_stock":true},{"title":"100ug","offer_id":45198338031795,"sku":"RP01789-100","price":560.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/files\/download_c6f48c07-4e64-47e7-9bbb-a94792e69708.png?v=1766960763","url":"https:\/\/afsbio.com\/products\/recombinant-rat-il-3-protein-rp01789","provider":"AFSBio Inc.","version":"1.0","type":"link"}