{"product_id":"recombinant-rat-interferon-γ-rrtfn-γ-pr3008","title":"Recombinant Rat Interferon-γ (rRtFN-γ) - PR3008","description":"\u003cp\u003eRecombinant Rat Interferon-γ (rRtFN-γ)\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Numbers: PR3008-20, PR3008-100, PR3008-1000\u003c\/p\u003e\n\n\u003cp\u003eSizes: 20µg, 100µg, 1.0mg (Contact us for the 1.0mg option)\u003c\/p\u003e\n\n\u003cp\u003eSource: Escherichia coli\u003c\/p\u003e\n\n\u003cp\u003eMolecular Weight:Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 135 amino acids.\u003c\/p\u003e\n\n\u003cp\u003ePurity: \u0026gt;95% by SDS-PAGE and HPLC analyses.\u003c\/p\u003e\n\n\u003cp\u003eBiological Activity: Measured in an antiviral assay using L929 mouse fibrosarcoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is typically 1-3 ng\/mL, corresponding to a Specific Activity of ＞3.3 x 105 IU\/mg.\u003c\/p\u003e\n\n\u003cp\u003ePhysical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.\u003c\/p\u003e\n\n\u003cp\u003eAA Sequence: MQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: Less than 1EU\/mg of rRaIFN-γ as determined by LAL method.\u003c\/p\u003e\n\n\u003cp\u003eReconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg\/mL. Stock solutions should be apportioned into working aliquots and stored at \u0026lt;-20°C. Further dilutions should be made in appropriate buffered solutions.\u003c\/p\u003e\n\n\u003cp\u003eStorage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze\/thaw cycles.\u003c\/p\u003e\n\n\u003cp\u003eUsage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.   Made  in China\u003c\/p\u003e\n\n\u003cp\u003eInterferon-gamma (IFN-γ, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. Human IFN-γ is highly species specific and is biologically active only in human and primate cells.\u003cbr\u003e\nIFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-γ also augments TH1 cell expansion and may be required for TH1 cell differentiation.\u003c\/p\u003e","brand":"BioWorld","offers":[{"title":"20µg","offer_id":42880592183475,"sku":"PR3008-20","price":260.23,"currency_code":"CAD","in_stock":true},{"title":"100µg","offer_id":42880592216243,"sku":"PR3008-100","price":490.83,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/thumbnail_d1447bac803ec9be_11-14-09-19-51_46df9dd1-cd3e-4cc6-afbf-fbafcdc9d1c2.jpg?v=1701982021","url":"https:\/\/afsbio.com\/products\/recombinant-rat-interferon-%ce%b3-rrtfn-%ce%b3-pr3008","provider":"AFSBio Inc.","version":"1.0","type":"link"}