{"product_id":"recombinant-sdf-1α-cxcl12-mouse-bk0282","title":"Recombinant SDF-1α\/CXCL12, Mouse - BK0282","description":"\u003cp\u003eRecombinant SDF-1α\/CXCL12, Mouse\u003c\/p\u003e\n\n\u003cp\u003eCatalogue Numbers: BK0282-5, BK0282-25\u003c\/p\u003e\n\n\u003cp\u003eSizes: 5μg, 25μg\u003c\/p\u003e\n\n\u003cp\u003eSource: CHO\u003c\/p\u003e\n\n\u003cp\u003eMolecular Weight: 8 kDa, observed by reducing SDS-PAGE.\u003c\/p\u003e\n\n\u003cp\u003ePurity: \u0026gt; 95% as analyzed by SDS-PAGE.\u003c\/p\u003e\n\n\u003cp\u003eBiological Activity: The EC50 value of mouse SDF-1 α\/CXCL12 on Caˆ2+ mobilization assay in CHO-K1\/Gα15\/mCXCR4 cells (human Gα15 and mCXCR4 stably expressed in CHO-K1 cells) is less than 1.5 μg\/ml.\u003c\/p\u003e\n\n\u003cp\u003ePhysical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.\u003c\/p\u003e\n\n\u003cp\u003eFormulation: Lyophilized after extensive dialysis against PBS.\u003c\/p\u003e\n\n\u003cp\u003eAA Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK\u003c\/p\u003e\n\n\u003cp\u003eEndotoxin: \u0026lt; 0.2 EU\/μg, determined by LAL method.\u003c\/p\u003e\n\n\u003cp\u003eReconstitution: Reconstituted in ddH2O or PBS at 100 μg\/ml.\u003c\/p\u003e\n\n\u003cp\u003eStorage: Lyophilized recombinant Mouse SDF‑1 α\/CXCL12 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse SDF‑1 α\/CXCL12 should be stable up to 1 week at 4°C or up to 3 months at -20°C.\u003c\/p\u003e\n\n\u003cp\u003eUsage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.\u003c\/p\u003e\n\n\u003cp\u003eDescription: SDF-1 α and SDF-1 β, members of the chemokine α subfamily that lack the ELR domain, were initially identified using the signal sequence trap cloning strategy from a mouse bone-marrow stromal cell line. SDF-1 α and SDF-1 β cDNAs encode precursor proteins of 89 and 93 amino acid residues, respectively. Both SDF-1 α and SDF-1 β are encoded by a single gene and arise by alternative splicing. The two proteins are identical except for the four amino acid residues that are present in the carboxy-terminus of SDF-1 β and absent from SDF-1 α. SDF-1\/PBSF is highly conserved between species, with only one amino acid substitution between the mature human and mouse proteins. SDF-1\/PBSF acts via the chemokine receptor CXCR4 and has been shown to be a chemoattractant for T-lymphocytes, monocytes, pro- and pre-B cells, but not neutrophils. Mice lacking SDF-1 or CXCR4 have been found to have impaired B-lymphopoiesis, myelopoiesis, vascular development, cardiogenesis and abnormal neuronal cell migration and patterning in the central nervous system.Recombinant Mouse SDF-1 α\/CXCL12 produced in CHO cells is a polypeptide chain containing 68 amino acids. A fully biologically active molecule, rm SDF-1 β\/CXCL12 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.\u003c\/p\u003e","brand":"BioWorld","offers":[{"title":"5μg","offer_id":42882259681459,"sku":"BK0282-5","price":256.94,"currency_code":"CAD","in_stock":true},{"title":"25μg","offer_id":42882259714227,"sku":"BK0282-25","price":691.77,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/thumbnail_d1447bac803ec9be_11-14-09-19-51_5bb168f8-234f-45e5-bd89-c5623dfe7f1b.jpg?v=1702050226","url":"https:\/\/afsbio.com\/products\/recombinant-sdf-1%ce%b1-cxcl12-mouse-bk0282","provider":"AFSBio Inc.","version":"1.0","type":"link"}