{"product_id":"recombinant-swine-il-6-proteinn-hisactive-pkss000005","title":"Recombinant Swine IL-6 protein(N-His)(active) - PKSS000005","description":"Recombinant Swine IL-6 protein(N-His)(active)\n\nSizes: 5μg, 20μg\n\nCatalogue Numbers: PKSS000005-5, PKSS000005-20\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: IL-6\n\nTarget Symptom: IFN-β2; B-Cell Differentiation Factor (BCDF); BSF-2; HPGF; HSF; MGI-2\n\nTarget Species: Porcine\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: P26893\n\nAccession: P26893\n\nBackground: Interleukin-6 (IL-6) is a multifunctional α -helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. It exerts actions through the its heterodimeric receptor composed of IL-6R that lacks the tyrosine\/kinase domain and binds IL-6 with low affinity, and ubiquitously expressed glycoprotein 130 (gp130) that binds the IL-6. IL-6R complex with high affinity and thus transduces signals. IL-6 is also involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.\n\nActivity: Measure by its ability to induce proliferation in T1165. 85. 2.1 cells. The ED50 for this effect is \u0026lt; 1. 5 ng\/mL.\n\nSequence: MNSLSTSAFSPVAFSLGLLLVMATAFPTPERLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 7.4\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: Please contact us for more information.\n\nCalculated MW: 24.78 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"5μg","offer_id":43118188200115,"sku":"PKSS000005-5","price":277.2,"currency_code":"CAD","in_stock":true},{"title":"20μg","offer_id":43118188232883,"sku":"PKSS000005-20","price":693.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_c079b780-3388-4dc7-ba5f-0c0b9da8ad61.png?v=1709637761","url":"https:\/\/afsbio.com\/products\/recombinant-swine-il-6-proteinn-hisactive-pkss000005","provider":"AFSBio Inc.","version":"1.0","type":"link"}