{"product_id":"recombinant-swine-tnf-alpha-proteinn-hisactive-pkss000010","title":"Recombinant Swine TNF alpha protein(N-His)(active) - PKSS000010","description":"Recombinant Swine TNF alpha protein(N-His)(active)\n\nSizes: 5μg, 20μg\n\nCatalogue Numbers: PKSS000010-5, PKSS000010-20\n\nCitations, Manuals and MSDS Available upon request.\n\nAbbreviation: TNF alpha\n\nTarget Symptom: TNFSF2; Cachectin; Differentiation-inducing factor (DIF); Necrosin; Cytotoxin; TNSF1A\n\nTarget Species: Porcine\n\nExpression Host: E.coli\n\nApplication: Cell culture\n\nFusion Tag: N-His\n\nUNIProt ID: P23563\n\nAccession: P23563\n\nBackground: Tumor necrosis factor alpha (TNFα) is the prototypic ligand of the TNF superfamily. TNFα forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1, p55R) and TNF-R2 (TNF receptor type 2, p75R). TNFα is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFα is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells.\n\nActivity: Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED50 for this effect is \u0026lt; 15 pg\/mL.\n\nSequence: MSTESMIRDVELAEEALAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFEVIGPQKEEFPAGPLSINPLAQGLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL\n\nPurity: \u0026gt; 98 % as determined by reducing SDS-PAGE.\n\nFormulation: Lyophilized from sterile PBS, pH 7.4\nNormally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.\nPlease refer to the specific buffer information in the printed manual.\n\nReconstitution: Please refer to the printed manual for detailed information.\n\nEndotoxin: Please contact us for more information.\n\nCalculated MW: 26.08 kDa\n\nStorage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at \u0026lt; -20℃ for 3 months.\n\nShipping: This product is provided as lyophilized powder which is shipped with ice packs.\n\nResearch Use Only","brand":"Elabscience","offers":[{"title":"5μg","offer_id":43118189019315,"sku":"PKSS000010-5","price":277.2,"currency_code":"CAD","in_stock":true},{"title":"20μg","offer_id":43118189052083,"sku":"PKSS000010-20","price":693.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0305\/9482\/6376\/products\/logo_new_9f99d4c5-532f-42a3-a9c0-83a2147eb011.png?v=1709637776","url":"https:\/\/afsbio.com\/products\/recombinant-swine-tnf-alpha-proteinn-hisactive-pkss000010","provider":"AFSBio Inc.","version":"1.0","type":"link"}