Bioworld
A35R Recombinant Protein - NCP0411
A35R Recombinant Protein - NCP0411
Couldn't load pickup availability
A35R Recombinant Protein
Sizes: 500μg, 1mg
Catalogue Numbers: NCP0411-500, NCP0411-1000
Lead times: 1-2 weeks, if manufacturer has product in stock
Manufacturer/Ship Location: China
Background: Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , mμltiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus mμltiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.
Category: Protein
Host: E. coli
Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Molecular Weight: ~14kDa
Solubility: PBS, 4M Urea, PH7.4
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Restriction Sites: NdeI-XhoI
SwissProt: Q80KX2
Tag: His-tag
Amino Acid Sequence: HMVRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTLE
Expression Vector: pet-22b(+)
Research Use Only
