BioWorld
Anti - imipenemase Metallo - β - lactamase (IMP), Rabbit mAb - MB67275
Anti - imipenemase Metallo - β - lactamase (IMP), Rabbit mAb - MB67275
Couldn't load pickup availability
Anti-imipenemase Metallo-β-lactamase (IMP), Rabbit mAb
Sizes: 50µl, 100µl
Catalogue Numbers: MB67275-50, MB67275-100
Swiss-Prot: HAS1313528.1
Host: 293F
Reactivity: IMP-1
Applications: WB, ELISA
All Applications: WB: 1:500~1:2000
ELISA: 1:5000~10000
Background: Rabbit IgG1, Kappa
Product: 1mg/ml in PBS, pH7.4
Purification and Purity: The antibody was affinity-purified by protein A and the purity is > 95% (by SDS-PAGE).
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Specificity: Using phage display technology, library of antibody was constructed from peripheral blood of New Zealand rabbits which had been immunized by IMP protein. Screening the library with recombinant IMP protein, the target antibody was obtained and then was purified by recombinant and expression.
Extra Notes: By using Indirect ELISA to detect the binding activity of IMP rabbit monoclonal antibody and recombinant IMP protein. Antigen concentration was 1 µ g/ml.
Note: For research use only, not for use in diagnostic procedure.
Immunogen: MSKLSVFFIFLFCSIATAAEPLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVDAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFGGVNYWLVKNKIEVFYPGPGHTPDNLVVWLPERKILFGGCFIKPYGLGNLGDANLEAWPKSAKLLISKYGKAKLVVPSHSEAGDASLLKLTLEQAVKGLNESKKPSKLSNHHHHHH
Conjugate: Unconjugated
Modification: Unmodified