Anti-Twin-Strep-tag Antibody (SAA0348)
Sizes: 50μg, 100μg
Catalogue Numbers: YP396033-50, YP396033-100
Citations, Manuals and MSDS Available upon request.
Host species: Mouse
Species reactivity: General
Form: Liquid
Storage buffer: 0.01M PBS, pH 7.4.
Clonality: Monoclonal
Isotype: IgG2b
Applications: ELISA, WB
Target: Twin-Strep-tag, Twin Strep tag, TwinStrep tag,Streptag,Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK
Purification: Protein A/G purified from cell culture supernatant.
Stability and Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term.
For research use only.