Skip to product information
1 of 1

abinScience

Anti-Twin-Strep-tag Antibody (SAA0348) - YP396033

Anti-Twin-Strep-tag Antibody (SAA0348) - YP396033

Regular price $179.20 CAD
Regular price Sale price $179.20 CAD
Sale Sold out
Size
Quantity

Get a quote

Anti-Twin-Strep-tag Antibody (SAA0348)

Sizes: 50μg, 100μg

Catalogue Numbers: YP396033-50, YP396033-100

Citations, Manuals and MSDS Available upon request.

Host species: Mouse

Species reactivity: General

Form: Liquid

Storage buffer: 0.01M PBS, pH 7.4.

Clonality: Monoclonal

Isotype: IgG2b

Applications: ELISA, WB

Target: Twin-Strep-tag, Twin Strep tag, TwinStrep tag,Streptag,Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Purification: Protein A/G purified from cell culture supernatant.

Stability and Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term.

For research use only.

View full details