Product Description

Monoclonal Antibody to Exenatide (EXT)

Sizes: 100µL, 200µL, 500µL, 1ml, 5mL

Catalogue Numbers: MAV768Ge22-100, MAV768Ge22-200, MAV768Ge22-500, MAV768Ge22-1000, MAV768Ge22-5000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Category: Monoclonal Antibodies(Primary Abs)

Reactivity: General

Host: Mouse

Applications: WB, IHC, ICC, IP

Alternate Names: Byetta, Bydureon, Exendin-4

Clonality: Monoclonal Antibody

Immunogen: CPV768Ge11

Immunogen Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Isotype: IgG2a Kappa

Target: Exenatide

Dilution: Western blotting: 0.01-2µg/mL,
Immunohistochemistry: 5-20µg/mL,
Immunofluorescence:5-20µg/mL,
Optimal working dilutions must be determined by end user.

Storage: Store at 2°C to 8°C for frequent use, -20°C for 12 months

Buffer: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol

Concentration: 1mg/mL

Potency (Clone Number): C3

State: Liquid

Purification: Protein A + Protein G affinity chromatography

Expiration: Stable for 12 months if correctly stored.

Research Use Only