ABclonal
Recombinant Human CCL4/MIP-1β Protein - RP01654
Recombinant Human CCL4/MIP-1β Protein - RP01654
Couldn't load pickup availability
Recombinant Human CCL4/MIP-1β Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01654-10, RP01654-20, RP01654-50, RP01654-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human CCL4/MIP-1β Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Asn92) of human CCL4/MIP-1β (Accession #NP_002975.1) fused with and a hFc tag at the C-terminus.
Alternate Names: ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta; CCL4
SWISS: P13236
GeneID: 6351
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
