Product Description

Recombinant Human Glia Maturation Factor beta (rHuGMF-β)

Catalogue Numbers: PR1033-2, PR1033-10, PR1033-1000

Sizes: 2µg, 10µg, 1.0mg (Contact us for the 1.0mg option)

Source: Escherichia coli

Molecular Weight:Approximately 16.5 KDa, a single non-glycosylated polypeptide chain containing 141 amino acids.

Purity: >98% by SDS-PAGE and HPLC analyses.

Biological Activity: Data Not Available.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.

AA Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNT
EDLTEEWLREKLGFFH

Endotoxin: Less than 1EU/g of rHuGMF-b as determined by LAL method.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

GMF-β, a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family. GMF-β appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.