ABclonal
Recombinant Human LILRA2/ILT-1/CD85h Protein - RP01332
Recombinant Human LILRA2/ILT-1/CD85h Protein - RP01332
Couldn't load pickup availability
Recombinant Human LILRA2/ILT-1/CD85h Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01332-10, RP01332-20, RP01332-50, RP01332-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human LILRA2/ILT-1/CD85h Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24 -Asn449) of Human LILRA2 (Accession #NP_006857.2) fused with an 6×His tag at the C-terminus.
Alternate Names: LILRA2, CD85H, ILT1, LIR-7, LIR7
SWISS: Q8N149
GeneID: 11027
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: LILRA2 (Leukocyte immunoglobulin like receptor A2), also known as CD85H and LIR7 (Leukocyte immunoglobulin-like receptor 7).This encoded protein is an activating receptor that inhibits dendritic cell differentiation and antigen presentation and suppresses the innate immune response. It is an activating receptor highly expressed in inflammatory tissues and is involved in granulocyte and macrophage activation. LILRA2 is primarily expressed on the surface of cells of the innate immunity including monocytes, macrophages, neutrophils, basophils, and eosinophils but not on lymphocytes and NK cells. LILRA2 cross-linking on monocytes induces pro-inflammatory cytokines while inhibiting dendritic cell differentiation and antigen presentation. Diseases associated with LILRA2 include Tuberculoid Leprosy and Leprosy 3.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQC VSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDF LQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMG PVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVEN
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
