ABclonal
Recombinant Human LILRA5/ILT-11/CD85f Protein - RP01318
Recombinant Human LILRA5/ILT-11/CD85f Protein - RP01318
Couldn't load pickup availability
Recombinant Human LILRA5/ILT-11/CD85f Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01318-10, RP01318-20, RP01318-50, RP01318-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human LILRA5/ILT-11/CD85f Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly42-Arg268) of Human LILRA5 (Accession #NP_067073.1) fused with an 6×His tag at the C-terminus.
Alternate Names: CD85, CD85F, ILT-11, ILT11, LILRB7, LIR-9, LIR9, LILRA5
SWISS: A6NI73
GeneID: 353514
Species: Human
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: LILRA5 is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LILR are a family of receptors possessing extracellular immunoglobulin domains. They are also known as CD85, ILTs, and can exert immunomodulatory effects on a wide range of immune cells. ILT-11 contains 2 Ig-like C2-type (immunoglobulin-like) domains. It can be detected n tissues of the hematopoietic system, including bone marrow, spleen, lymph node, and peripheral leukocytes. Crosslink of ILT-11 on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARF SIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQ CGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHI LQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
