Skip to product information
1 of 1

ABclonal

Recombinant Human LILRB1/ILT-2/CD85j Protein - RP01331

Recombinant Human LILRB1/ILT-2/CD85j Protein - RP01331

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Human LILRB1/ILT-2/CD85j Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01331-10, RP01331-20, RP01331-50, RP01331-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Human LILRB1/ILT-2/CD85j Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-His458) of Human LILRB1 (Accession #NP_006660.4) fused with an 6×His tag at the C-terminus.

Alternate Names: LILRB1, CD85J, ILT-2, ILT2, LIR-1, LIR1, MIR-7, MIR7, PIR-B, PIRB

SWISS: Q8NHL6

GeneID: 10859

Species: Human

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD85 antigen-like family member J (CD85J) is also known as Leukocyte immunoglobulin-like receptor subfamily B member 1 (LILRB1 or LIR-1), Immunoglobulin-like transcript 2 (ILT-2), Monocyte/macrophage immunoglobulin-like receptor 7 (MIR7), which belongs to leukocyte immunoglobulin-like receptor (LIR) family.CD85J / LILRB1 Contains 4 Ig-like C2-type (immunoglobulin-like) domains. CD85J / LIR-1 is expressed predominantly on B-cells and monocytes. CD85J is receptor for class I MHC antigens and recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles and is also receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding results in inhibitory signals and down-regulation of the immune response. CD85J / LILRB1 interaction with HLA-B or HLA-E leads to inhibition of the signal triggered by FCER1A and inhibits serotonin release. CD85J / LILRB1 inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVIL QCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGER DFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFP MGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details