Recombinant Monkeypox virus B16R Protein - RP01594

Recombinant Monkeypox virus B16R Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01594-10, RP01594-20, RP01594-50, RP01594-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Monkeypox virus B16R Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile25-Glu352) of monkeypox virus B16R (Accession #Q5IXK2) fused with a 6×His tag at the C-terminus.

Alternate Names: IFN-alpha/beta receptor glycoprotein; COP-167; B16R

SWISS: Q5IXK2

GeneID: 928988

Species: Monkeypox virus

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: IDIENEITEFFNKMRDTLPAKDSKWLNPVCMFGGTMNDMAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGVVRSHVWKPSSCIPKTYELGTYDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDFKYSQAGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCSAVSTSLFVDDVLIEWKNPSGWIIGLDFGVYSILTSRGGITEATLYFENVTEEYIGNTYTCRGHNYYFDKTLTTTVVLE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only