ABclonal
Recombinant Mouse IL-21 Protein - RP00664
Recombinant Mouse IL-21 Protein - RP00664
Couldn't load pickup availability
Recombinant Mouse IL-21 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00664-10, RP00664-20, RP00664-50, RP00664-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-21 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His18-Ser146) of Mouse IL-21 (Accession #NP_068554.1) fused with a hFc tag at the C-terminus.
Alternate Names: Il21, Interleukin-21, IL-21
SWISS: Q9ES17
GeneID: 60505
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-21 (IL-21) is an approximately 14 kDa four-helix-bundle cytokine in the family of cytokines that utilize the common gamma chain ( gamma c) as a receptor subunit. gamma c is also a subunit of the receptors for IL-2, IL-4, IL-7, IL-9, and IL-15. IL-21 is produced by activated T follicular helper cells (Tfh), Th17 cells, and NKT cells. It exerts its biological effects through a heterodimeric receptor complex of gamma c and the IL-21-specific IL-21 R. Tfh-derived IL-21 plays an important role in the development of humoral immunity through its autocrine effects on the Tfh cell and paracrine effects on immunoglobulin affinity maturation, plasma cell differentiation, and B cell memory responses. It is also required for the migration of dendritic cells to draining lymph nodes. IL-21 regulates several aspects of T cell function. It co‑stimulates the activation, proliferation, and survival of CD8+ T cells and NKT cells and promotes Th17 cell polarization. It blocks the generation of regulatory T cells and their suppressive effects on CD4+ T cells. IL-21 R engagement enhances the cytolytic activity and IFN-gamma production of activated NK cells but limits the expansion of resting NK cells. In addition, IL-21 suppresses cutaneous hypersensitivity reactions by limiting allergen-specific IgE production and mast cell degranulation. Dysregulation of the IL‑21/IL‑21 R system contributes to the development of multiple immunological disorders. The mouse IL‑21 precursor contains a predicted 17 amino acid (aa) signal sequence and a 129 aa mature chain. Mature mouse IL-21 shares 66%, 59%, 58%, and 88% aa sequence identity with mature canine, human, rabbit, and rat IL-21, respectively.
Source: HEK293 cells
Tag: C-hFC
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: KSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
