Skip to product information
1 of 1

Bioworld

Anti-imipenemase metallo-β-lactamase (IMP), Rabbit Monoclonal Antibody - MB67276

Anti-imipenemase metallo-β-lactamase (IMP), Rabbit Monoclonal Antibody - MB67276

Regular price $424.50 CAD
Regular price Sale price $424.50 CAD
Sale Sold out
Size
Quantity

Get a quote

Anti-imipenemase metallo-β-lactamase (IMP), Rabbit mAb

Sizes: 50μl, 100μl

Catalogue Numbers: MB67276-50, MB67276-100

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: Rabbit IgG1, Kappa

Category: Primary Antibody

Reactivity: IMP-H9

Host: 293F

Applications: WB, ELISA

Clonality: Monoclonal

Conjugate: Unconjugated

Modification: Unmodification

Immunogen: MSKLSVFFIFLFCSIATAAEPLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVDAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFGGVNYWLVKNKIEVFYPGPGHTPDNLVVWLPERKILFGGCFIKPYGLGNLGDANLEAWPKSAKLLISKYGKAKLVVPSHSEAGDASLLKLTLEQAVKGLNESKKPSKLSNHHHHHH

Dilution: WB: 1:500~1:2000
ELISA: 1:5000~10000

Purification: The antibody was affinity-purified by protein A and the purity is > 95% (by SDS-PAGE).

Specificity: Using phage display technology, library of antibody was constructed from peripheral blood of New Zealand rabbits which had been immunized by IMP protein. Screening the library with recombinant IMP protein, the target antibody was obtained and then was purified by recombinant and expression.

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

SwissProt: HAS1313528.1

Product: 1mg/ml in PBS,pH7.4

Research Use Only

View full details