Bioworld
Anti-Klebsiella pneumoniae carbapenemases (KPC), Rabbit Monoclonal Antibody - MB67277
Anti-Klebsiella pneumoniae carbapenemases (KPC), Rabbit Monoclonal Antibody - MB67277
Couldn't load pickup availability
Anti-Klebsiella pneumoniae carbapenemases (KPC), Rabbit mAb
Sizes: 50μl, 100μl
Catalogue Numbers: MB67277-50, MB67277-100
Lead times: 1-2 weeks, if manufacturer has product in stock
Manufacturer/Ship Location: China
Background: Rabbit IgG1, Kappa
Category: Primary Antibody
Reactivity: KPC-1F
Host: 293F
Applications: WB, ELISA
Clonality: Monoclonal
Conjugate: Unconjugated
Modification: Unmodification
Immunogen: SLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQA
GLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQHHHHHH
Dilution: WB: 1:500~1:2000
ELISA: 1:5000~10000
Purification: The antibody was affinity-purified by protein A and the purity is > 95% (by SDS-PAGE).
Specificity: Using phage display technology, library of antibody was constructed from peripheral blood of New Zealand rabbits which had been immunized by KPC protein. Screening the library with recombinant KPC protein, the target antibody was obtained and then was purified by recombinant and expression.
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SwissProt: QBC89188.1
Product: 1mg/ml in PBS,pH7.4
Research Use Only
