Product Description

CD102 Recombinant Protein

Catalogue Number: NCP0374-500, NCP0374-1000

Sizes: 500ug, 1mg

Swiss-Prot: P13598

Host: E.coli

Tag: His-tag

AA Sequence: KVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLDEQAQWKHYLVSNISHDt VLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPt VEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAPKMLEIYEPVSDSQ

Restriction Sites: NdeI-XhoI

Background: Intercellular cell adhesion molecule-2 (CD102/ICAM-2) is a cell surface glycoprotein that belongs to the immunoglobulin superfamily (IgSF) of adhesion molecules. Like CD54/ICAM-1, CD102/ICAM-2 is a ligand that binds the leukocyte adhesion molecule LFA-1 (leukocyte function-associated antigen-1), which mediates intercellular interactions between immune cells and other cell types.
Expression of CD102/ICAM-2 has been shown to affect angiogenesis, cellular radioresistance and anti-tumor immune response. Along with CD54/ICAM-1, CD102/ICAM-2 mediates T cell crawling and diapedesis across the blood-brain barrier, as well as T cell migration across the bronchial epithelium. CD102/ICAM-2 interaction with the actin cytoskeleton through α-actinin has been shown to limit the mobility on neuroblastoma cells, and this effect is dependent on glycosylation of CD102/ICAM-2.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~30kDa

Notes: For research use only, not for use in diagnostic procedure.