Product Description

CD207 Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0340-500, NCP0340-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: Langerin (CD207) is a C-type lectin receptor whose expression is restricted mainly to dendritic cells in the skin including Langerhans cells in the epidermis and langerin+/CD103+ dermal dendritic cells. Langerin is found on the cell surface and within rod-shaped organelles called Birbeck granμles, and its expression is required for the formation of Birbeck granμles. Langerin recognizes carbohydrate motifs on the surface of pathogens, resμlting in endocytosis of the pathogen into Birbeck granμles, degradation of the pathogen, and antigen presentation to T cells.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~35kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: Q9UJ71

Tag: His-tag

Amino Acid Sequence: PRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFL
KLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKL
LKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYK
TAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQ
AWNDAPCDKTFLFICKRPYVPSEP

Expression Vector: pet-22b(+)

Research Use Only