Product Description

CD218b Recombinant Protein

Catalogue Number: NCP0341-500, NCP0341-1000

Sizes: 500ug, 1mg

Swiss-Prot: O95256

Host: E.coli

Tag: His-tag

AA Sequence: MFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSCQSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTYVCDYTQSDt VSSWt VRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEVSVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKR

Restriction Sites: NdeI-XhoI

Background: Interleukin-18 (IL-18) has been identified as a molecule that induces IFN-γ production and enhances NK cell cytotoxicity. IL-18 receptor (IL-18R) is a type I membrane protein present in lung, leukocytes, spleen, liver, thymus, prostate, small intestine, colon, placenta and heart, and absent from brain, skeletal muscle, pancreas and kidney. IL-18R is present in Hodgkin’s disease cell lines, and does not bind IL-1α or IL-1β. The association of IL-18 to IL-18R leads to activation of NFκB. At present two subunits of IL-18R have been characterized: IL-18Rα and IL-18Rβ. IL-18Rα has been described as the ligand-binding chain and IL-18Rβ as the signal-transduction chain.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~43kDa

Notes: For research use only, not for use in diagnostic procedure.