BioWorld
CD221 Recombinant Protein - NCP0312
CD221 Recombinant Protein - NCP0312
Couldn't load pickup availability
CD221 Recombinant Protein
Catalogue Number: NCP0312-500, NCP0312-1000
Sizes: 500ug, 1mg
Swiss-Prot: P08069
Host: E.coli
Tag: His-tag
AA Sequence: DVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERt VISNLRPFTLYR
IDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNG
LILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPV
FFYVQAKTGYENFIH
Restriction Sites: NdeI-XhoI
Background: Type I insulin-like growth factor receptor (IGF-IR) is a transmembrane receptor tyrosine kinase that is widely expressed in many cell lines and cell types within fetal and postnatal tissues. Receptor autophosphorylation follows binding of the IGF-I and IGF-II ligands. Three tyrosine residues within the kinase domain (Tyr1131, Tyr1135, and Tyr1136) are the earliest major autophosphorylation sites. Phosphorylation of these three tyrosine residues is necessary for kinase activation. Insulin receptors (IRs) share significant structural and functional similarity with IGF-I receptors, including the presence of an equivalent tyrosine cluster (Tyr1146/1150/1151) within the kinase domain activation loop. Tyrosine autophosphorylation of IRs is one of the earliest cellular responses to insulin stimulation. Autophosphorylation begins with phosphorylation at Tyr1146 and either Tyr1150 or Tyr1151, while full kinase activation requires triple tyrosine phosphorylation.
Soluble: PBS, 4M Urea, PH7.4
Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression Vector: pet-22b(+)
BioWorld Molecular Weight: ~25kDa
Notes: For research use only, not for use in diagnostic procedure.