Product Description

CD228 Recombinant Protein

Catalogue Number: NCP0364-500, NCP0364-1000

Sizes: 500ug, 1mg

Swiss-Prot: P08582

Host: E.coli

Tag: His-tag

AA Sequence: MGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAAQEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKGVKSCHTGINRt VGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSt VLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQRLFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGHEYLHAMKGLLCDPNRLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTLSGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGFGSPAGWDVPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENAGDVAFVRHTt VFDNTNGHNSEPWAAELRSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFt VYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDAt VRAVPVGEKTTYRGWLGLDYVAALEGMSSQQC

Restriction Sites: NdeI-XhoI

Background: Melanotransferrin is a member of the transferrin family of iron-binding proteins, which also includes serum transferrin, lactoferrin, and ovotransferrin, and it is highly expressed on melanoma cells. Melanotransferrin, also designated p97, shares a high degree of homology with transferrin, but does not play a significant role in the uptake of iron. Melanotransferrin utilizes a member of the low-density lipoprotein receptor family for transendothelial transport, which is not as efficient as the transport of transferrin through the corresponding transferrin receptor. The gene encoding human melanotransferrin maps to chromosome 3q29, and is predominantly expressed as either a membrane bound protein or a secreted form of the protein. Melanotransferrin is expressed in brain, where it may be involved in Alzheimer’s disease. Melanotransferrin may also protect against membrane-lipid peroxidation, possess a metalloprotease activity, and possibly participate in intracellular adhesion. Further research will be necessary to fully elucidate the functions of this protein.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~76kDa

Notes: For research use only, not for use in diagnostic procedure.