Product Description

CD229 Recombinant Protein

Catalogue Number: NCP0372-500, NCP0372-1000

Sizes: 500ug, 1mg

Swiss-Prot: Q9HBG7

Host: E.coli

Tag: His-tag

AA Sequence: KDSAPt VVSGILGGSVTLPLNISVDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNLTLNDAGSYKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILt VSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGEt VVGVLGEPVTLPLALPACRDTEKVVWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMTHVTLLIYRRLRKPKITWSLRHSEDGICRISLTCSVEDGGNt VMYTWTPLQKEAVVSQGESHLNVSWRSSENHPNLTCTASNPVSRSSHQFLSENICSGPERNTK

Restriction Sites: NdeI-XhoI

Background: T lymphocyte surface antigen Ly9 (CD229), also designated lymphocyte antigen 9 or cell-surface molecule Ly9, is a cell surface glycoprotein. CDC229 is a Type I membrane protein that is crucial in adhesion reactions between T lymphocytes and accessory cells (homophilic interaction). It belongs to the CD2 subfamily of the immunoglobulin gene superfamily of proteins (along with CD2, CD48, CD58, CD84, CD244 and CD150). Receptors of this family are important in cytokine production regulation and cytotoxicity of lymphocytes and NK cells. CD229 interacts with the SAP/SH2D1A protein. CD229 is expressed on mature B cells, T cells, thymocytes and NK cells.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~50kDa

Notes: For research use only, not for use in diagnostic procedure.