Bioworld
CD230 Recombinant Protein - NCP0345
CD230 Recombinant Protein - NCP0345
Couldn't load pickup availability
CD230 Recombinant Protein
Sizes: 500μg, 1mg
Catalogue Numbers: NCP0345-500, NCP0345-1000
Lead times: 1-2 weeks, if manufacturer has product in stock
Manufacturer/Ship Location: China
Background: The PRNP gene encodes the major prion protein (PrP, CD230), a widely-expressed glycoprotein expressed at high levels in the central nervous system. While the typical cellμlar function of PrP is not well defined, it is a putative antioxidant and a metal-binding protein that may be involved in signal transduction. Prion proteins can adopt different conformations; the cellμlar PrPc prion protein may be converted following translation into the β-sheet-rich scrapie isoform (PrPsc) responsible for several prion diseases, including bovine spongiform encephalopathy and human Creutzfeldt-Jakob disease. Unlike most neurodegenerative diseases, prion diseases are infectious as prions are capable of propagating by conferring an abnormally folded state onto properly folded cellμlar proteins. In addition, the cellμlar PrPc has may be involved in β-amyloid peptide oligomerization and synaptic toxicity.
Category: Protein
Host: E. coli
Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Molecular Weight: ~30kDa
Solubility: PBS, 4M Urea, PH7.4
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Restriction Sites: NdeI-XhoI
SwissProt: P04156
Tag: His-tag
Amino Acid Sequence: MKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS
Expression Vector: pet-22b(+)
Research Use Only
