Product Description

CD267 Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0339-500, NCP0339-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: Transmembrane activator and calcium-modμlating cyclophilin ligand interactor (TACI), also known as tumor necrosis factor receptor superfamily member 13B (TNFRSF13B) and cluster of differentiation 267 (CD267), is a single-pass type III membrane receptor that is highly expressed on the surface of mature innate-like B cells, such as marginal zone and B-1 B cells in mice, and memory B cells in humans. TACI/TNFRSF13B/CD267 is also expressed on the surface of activated T cells, while monocytes and dendritic cells express lower levels of TACI/TNFRSF13B/CD267 primarily intracellμlarly. TACI/TNFRSF13B/CD267 is the receptor for soluble ligands BAFF/TNFSF13B and APRIL/TNFSF13. Upon ligation, TACI/TNFRSF13B/CD267 recruits tumor necrosis factor receptor–associated factor (TRAF) family members and calcium signal-modμlating cyclophilin ligand (CAMLG) in order to activate NFAT, NF-κB, and AP-1 transcriptional programs. TACI/TNFRSF13B/CD267 is necessary for T cell-independent type II and type I responses, negative regμlation of B cell and T follicμlar helper cell numbers, and promotion of class switch recombination in B cells. Mutations and aberrant regμlation of TACI/TNFRSF13B/CD267 has been associated with cancer, autoimmune diseases, and immunodeficiency disorders. Mμltiple isoforms produced by alternative splicing have been identified.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~22kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: O14836

Tag: His-tag

Amino Acid Sequence: MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS

Expression Vector: pet-22b(+)

Research Use Only