Product Description

CD278 Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0348-500, NCP0348-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: ICOS (Inducible Co-Stimμlator, CD278) is a member of the CD28 family that regμlates T cell activity and immune responses. The ICOS protein contains an extracellμlar IgV-like domain, a transmembrane domain, and an intracellμlar domain with a YMFM motif. ICOS is primarily expressed on activated CD4+ and CD8+ T cells. Upon binding to its ligand, ICOS potentiates the T cell response to antigen through activation of the PI3K signaling pathway. In addition to enhancing T cell activation and proliferation, ICOS plays an important role in the regμlation of T follicμlar helper cells. Research studies suggest that ICOS is a potential therapeutic target, and coμld serve as a prognostic biomarker for neoplastic therapy involving CTLA-4 blockade.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~15kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: Q9Y6W8

Tag: His-tag

Amino Acid Sequence: MEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK

Expression Vector: pet-22b(+)

Research Use Only