Product Description

CD299 Recombinant Protein

Sizes: 500μg, 1mg

Catalogue Numbers: NCP0355-500, NCP0355-1000

Lead times: 1-2 weeks, if manufacturer has product in stock

Manufacturer/Ship Location: China

Background: Dendritic cells (DC) are antigen-presenting immune system cells that are present on peripheral mucosal tissues and migrate to lymphoid tissues. DC-SIGN (DC-specific ICAM-3 grabbing nonintegrin) is a type II membrane protein that is exclusively expressed by DC. DC-SIGN, also designated CD209, binds to ICAM-3 to mediate the initial interaction between DC and resting T cells through the immunological synapse. The DC that are present in the initial sites of HIV-1 infection capture HIV-1 through DC-SIGN, which then facilitates the migration of DC to areas of T cell-rich secondary lymphoid organs, where it promotes efficient trans HIV-1 infection of these T cells. DC-SIGNR (DC-SIGNrelated molecμle), also designated CD209L and L-SIGN (liver/lymph nodespecific ICAM-3 grabbing nonintegrin), is a type II integral membrane protein that is 77% identical to DC-SIGN. It is expressed on sinusoidal endothelial cells and binds the E2 glycoproteins of the hepatitis C virus.

Category: Protein

Host: E. coli

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Molecular Weight: ~38kDa

Solubility: PBS, 4M Urea, PH7.4

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Restriction Sites: NdeI-XhoI

SwissProt: Q9H2X3

Tag: His-tag

Amino Acid Sequence: MQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Expression Vector: pet-22b(+)

Research Use Only